PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G12350.1
Common NameAtMYB42, MYB42
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 286aa    MW: 32402.2 Da    PI: 5.5874
Description myb domain protein 42
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G12350.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.63.8e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ +   G  +W++ ++  g++R++k+c++rw +yl
      AT4G12350.1 14 KGPWTAEEDKKLINFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding50.64.5e-1671111547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +  E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
      AT4G12350.1  71 SDAEEQLVIDLHALLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                      778***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-20562IPR009057Homeodomain-like
PROSITE profilePS5129412.864961IPR017930Myb domain
SMARTSM007176.2E-121363IPR001005SANT/Myb domain
SuperFamilySSF466898.99E-2613108IPR009057Homeodomain-like
PfamPF002497.7E-141461IPR001005SANT/Myb domain
CDDcd001678.87E-91661No hitNo description
PROSITE profilePS5129427.21462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2463116IPR009057Homeodomain-like
SMARTSM007171.1E-1466114IPR001005SANT/Myb domain
CDDcd001674.22E-1171112No hitNo description
PfamPF002493.0E-1471111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000230anatomyinflorescence meristem
PO:0005352anatomyxylem
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MGRQPCCDKL MVKKGPWTAE EDKKLINFIL TNGHCCWRAL PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL SDAEEQLVID LHALLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLLKME  120
IDPSTHQPLN KVFTDTNLVD KSETSSKADN VNDNKIVEID GTTTNTIDDS IITHQNSSND  180
DYELLGDIIH NYGDLFNILW TNDEPPLVDD ASWSNHNVGI GGTAAVAASD KNNTAAEEDF  240
PERSFEKQNG ESWMFLDYCQ EFGVEDFGFE CYHGFGQSSM KTGHKD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28141167108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible254813_at0.0
Expression AtlasAT4G12350-
AtGenExpressAT4G12350-
ATTED-IIAT4G12350-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB42).
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G12350.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G32770 (A)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G12350
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1759990.0AF175999.1 Arabidopsis thaliana putative transcription factor (MYB42) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567390.40.0myb domain protein 42
SwissprotQ50EX61e-91ODO1_PETHY; Protein ODORANT1
TrEMBLQ9SPG10.0Q9SPG1_ARATH; Myb domain protein 42
STRINGAT4G12350.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Rogers LA, et al.
    Comparison of lignin deposition in three ectopic lignification mutants.
    New Phytol., 2005. 168(1): p. 123-40
    [PMID:16159327]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. Zhong R,Lee C,Zhou J,McCarthy RL,Ye ZH
    A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2763-82
    [PMID:18952777]
  6. Brady SM, et al.
    A stele-enriched gene regulatory network in the Arabidopsis root.
    Mol. Syst. Biol., 2011. 7: p. 459
    [PMID:21245844]
  7. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]